PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g29324.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 660aa    MW: 75116.8 Da    PI: 8.4481
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g29324.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR139.42e-122613091
              FAR1 30 krtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91
                      +r + Cs++g+++  k+   +++r ++++r+gCka +k+k++   +w  +++eleHnH+l+p
  Bradi3g29324.1.p  2 SRLYACSRQGSSTFYKTG-GERKRAKMSKRVGCKAAVKIKLK-GTEWFYENVELEHNHALNP 61
                      5779*********99988.99999******************.99**************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-9261IPR004330FAR1 DNA binding domain
PfamPF105516.1E-31170263IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MSRLYACSRQ GSSTFYKTGG ERKRAKMSKR VGCKAAVKIK LKGTEWFYEN VELEHNHALN  60
PNPYPVIMEY VDDLQQSGVS PIATMNVLAT LNGDPELLPM NDRDLENRRA ANLREEQVVD  120
VKKLMAFFSE YRTHNPKFYY DIEFDSAGVV KNIFWSHASC QANYAEFGDV VTFDTTYRSN  180
FYCMPLGMFV GSNHHLQNVI FGFVLVRDET QKTFEWVFRT FKNCMEGKDP ICILTDQDQA  240
MANALQAVFV RTIHRLCRWH MLNKHTESLN KLYHSNKGLE EKLLTAVNHP LTPAVFENAW  300
QEMVSEYELE SDPTLCSLYE LRASWIASYF KDIFCGRMTS TQRSECMDRM VKRHHVDDST  360
PLHVFAKKMY QVLQRRKDAE GQETIASQAP PATKTNYPLE RQLSRIYTRA VFKKYQEAYV  420
AGTSFRTKND GPLLINEQIQ KLPSKYVLRR YTRNAHIDLH YDRNDTIQTG NDGLSKGGRN  480
SNMLRQAYAT IRAGIRSIVG YERYMTVMKE LREQLEEIPA DEMPVRDETA NDDPPDLLGT  540
ILKALRKSST KGSRAEDGAA PIIGARGPKM CTRTCSNCGL QQGHNKKSCP HPPQKFAVGG  600
TSAGRGRDRG RGRGRGRNAR GKGVVRTRRR LLDDEEDEDD HDGNDEEDSE SPCGSDSSA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1606616RDRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239771.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLI1IMG80.0I1IMG8_BRADI; Uncharacterized protein
STRINGBRADI4G22000.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.13e-67FAR1-related sequence 5